Tag Archives: Genome Editing

Genetische Ausnahmslosigkeit?

Peter Dabrock im Deutschen Ärzteblatt

Die Keimbahn als solche ist nicht sakrosankt. Das mag auf den ersten Eindruck erstaunen, weil viele Menschen die Keimbahn als etwas Besonderes einschätzen. Aber der Mensch geht in seiner Keimbahn nicht auf – das wäre eine ethisch unstatthafte Biologisierung menschlichen Daseins.

Die Keimbahn sakrosankt? Es ist ein klassische Strohmann Argument hier: irgendetwas behaupten, widerlegen und einen Schluss zu ziehen, der nicht gerechtfertigt ist.

Ohne hier einen genetischen Exzeptionalismus zu vertreten, ist die Keimbahn natürlich etwas Besonderes – der individuelle Code des Lebens, der Blueprint von drei Milliarden Basenpaaren anhand derer sich durch einen mehrfach abgesicherten Mechanismen jeder Mensch entwickelt hat. Und zwar indivduell, jeder Mensch einzigartig, als Kind seiner Eltern, das schätzen die meisten Menschen auch völlig richtig ein.

In der Keimbahn geht der Mensch nicht auf, er entwickelt sich daraus. Hier ist dann auch noch Ursache und Wirkung vertauscht, um das vernichtende Argument abzugeben – ethisch unstatthaft – mit entsprechenden Konsequenzen.

Die Menschwerdung ist etwas Besonderes, wie es Karl Eibl es wunderbar einmal beschrieben hat.

Und Gott der HERR machte den Menschen aus einem Erdenkloß, und blies ihm ein den lebendigen Odem in seine Nase. Und also ward der Mensch eine lebendige Seele.” (1. Mose 2,7). Diese alte Geschichte gibt knapp und schmeichelhaft Auskunft über die Stellung des Menschen in der Natur, aber sie wird in der Regel nur am Sonntag erzählt. Die andere, neuere und werktagsgeeignete Geschichte trägt so unangenehm plärrende Titel wie “Der nackte Affe” oder “Der dritte Schimpanse” oder “Von Menschen und anderen Tieren”. Sie hat zwar einige Plausibilität, wenn wir das Verhalten unserer Mitmenschen ansehen, aber uns selbst und ein paar Freunde würden wir gerne ausnehmen, sprechen deshalb lieber von Bewusstsein, Emanzipation von Naturzwängen, Emergenz und ähnlichen schwer definierbaren Kostbarkeiten, die uns letzten Endes doch eine Sonderstellung im Kosmos sichern sollen. Dagegen ist auch gar nichts einzuwenden. Auch der Elefant ist nicht irgendein Dahergelaufener, und wenn er sprechen könnte, würde er uns vielleicht ärgerlich versichern, dass auch er eine Sonderstellung im Kosmos hat. Eigentlich ist jede Gattung oder Art etwas Besonderes, sonst könnten wir sie ja nicht von anderen unterscheiden. Die Frage ist eher, ob das Besondere des Menschen ein besonders Besonderes, ein ganz Anderes ist.

 

Peter Dabrock zu Keimbahneingriffen

O-Ton Peter Dabrock “Apothekenschau” gestern (30.10.2019)  Darf man Erbgut korrigieren?

Herr Professor Dabrock, kürzlich wurden die ersten Menschen mit korrigierten Genen geboren. Was halten Sie davon?
Ich halte das aus mehrerern Gründen für verwerflich. So könnte das Ausschalten dieses speziellen Gens die Lebenserwartung bei den gerade geborenen Mädchen um zehn Jahre verkürzen.
Zudem wissen wir generell zu wenig über die Nebeneffekte von Genscheren. Denn sie schneiden das Erbgut nicht nur an der beabsichtigten Stelle. Niemand kennt die Folgen, die sich daraus ergeben. Auch deshalb hält keiner der führenden Wissenschaftler Genkorrekturen an der Keimbahn für verantwortbar.

Die Antwort enthält mehrere Fehler (wobei es natürlich schwierig ist, für einen evangelischen Theologen über Wissenschaft zu reden, die er nur vom Hörensagen kennt).
1. Die Lebenserwartung wird durch die Ausschaltung von CCR5 nicht verringert. Die einzige Arbeit, die das behauptet hat, wurde am 8.10.2019 zurückgezogen. Das sollte man wissen, wenn man darüber redet.
2. Die zweite Aussage ist auch falsch, denn wir wissen ziemlich genau, was die Genscheren für Nebeneffekte haben. Ich habe das für die Crispr Cas Twins vorgerechnet, sowohl für den Phänotyp als auch für die off-target Effekte. Die Folgen sind katastrophal, vermutlich der Grund, warum keiner die Kinder untersuchen darf.
3. Leider ist die ganze Diskussion Schnee vom letzten Jahr. Neuere prime editing Verfahren sind sehr präzise und können nach aktuellem Hochrechnung 90% der bekannten Mutationen reparieren. Damit ist aus technischer Sicht eine Genkorrektur verantwortbar.

Und wie steht es um die grundsätzliche Frage, ob man das darf?
Wir erreichen eine Schwelle, an der die Menschheit in der Lage ist, ihre eigenen biologischen Gurndlagen technisch zu manipulieren. Es ist eine Menschheitsfrage zu klären, ob wir das wollen oder nicht. Und darüber müssen wir zunächst eine gesellschaftliche Debatte führen. Deshalb halte ich es für ein ethisch niederes Motiv, wenn einzelne Forscher aus Ruhmsucht vorpreschen.

Der erste Satz antwortet nicht auf die “grundsätzliche” Frage ebensowenig wie der zweite  Satz.
Die “Menschheit” hat im übrigen eine Meinung dazu: Keine der großen Weltreligionen erlaubt solche Eingriffe (wie wir in einer noch nicht veröffentlichten Arbeit zeigen werden).
Und drittens, woher kennt Peter Dabrock idie ethische Motivation von He Jiankui, den er nie getroffen hat? Kollegen, die JK kennen, beschreiben seine Motivationslage als komplex, er ist in einr Gegend aufgewachsen in der ganze Dörfer an AIDS litten.

Der Deutsche Ethikrat fordert aktuell den globalen Stopp solcher Eingriffe. Hält er sie jedoch eventuell in der Zukunft für angemessen?
Ja, angenommen wir erreichen den Punkt, an dem wir solche Korrekturen für verantwortbar halten. Dann wäre es bei schweren Krankheiten sogar geboten, die Keimbahn zu korrigieren, wenn das die Chance bietet, Menschen gravierende Einschränkungen und den frühen Tod zu ersparen. Diesen Standpunkt vertritt die Mehrheit des Deutschen Ethikrats.

Ethik per Mehrheitsentscheidung hängt davon ab, wo die Mehrheiten gerade liegen. Heute hier, morgen da. Die Entscheidungen sollen zwar unpolitisch sein (§5 Ethikratgesetz) aber da die Mitglieder je zur Hälfte auf Vorschlag des Deutschen Bundestags und der Bundesregierung gewählt sind, ist jedes Statement des Ethikrates auch ein politisches Statement. C F Gethmann kritisiert ja auch unseren Problem-Monismus, dass die jeweiligen Wissenschaften sich jeweils auf ihr Problem konzentrieren müssen, während politisches Handeln bzw ethische Berwertung ein multidimensionales”Problemgefüge” bewältigen muss. Nur leider liegt der Ethikrat an so  vielen anderen Stellen immer wieder daneben, vermutlich weil ihm die Sachkenntnis der “Monisten” fehlt.

Es soll nun also geboten sein, die Keimbahn zu korrigieren? Auch von ethischer Seite sind die Interviewantworten von Dabrock ähnlich dubios, wie von medizinisch-biologischer Seite. Liegen hier nicht unüberwindbare Konfliktmöglichkeiten?  Es findet kaum ein Behinderter gut, was der Ethikrat sich hier sich ausgedacht hat. Es gibt zu viele Gründe, die gegen Keimbahneingriffe sprechen, deutlich mehr als der Ethikrat in seiner Stellungnahme aufgezählt hat.

Rhetorisch ist das Argument zudem schwach, denn um Menschen gravierende Einschränkungen und den frühen Tod zu ersparen, verhindert man auch nicht, dass sie sich schneller als 30 km/h bewegen.

Und spricht Peter Dabrock hier eigentlich für den Ethikrat (ist das Interview autorisiert?) Spricht er für die evangelische Kirche? Oder für die evangelische Theologie? Oder ist das Thema eigentlich völlig egal und  Dabrock spricht nur für sich selbst und das alles ist nur – wie er so gerne sagt – “Ruhmsucht”? Und hat er nicht 2017 gesagt, wir sind “meilenweit von einem Designerbaby entfernt”?

Ob ihr wirklich richtig steht, seht ihr, wenn das Licht angeht.

Ethics and eugenics

Nature has an piece highlighting the history of the ethics profession along side the history of eugenics: Ethical research — the long and bumpy road from shirked to shared. Connecting these dots is only possible by partial omissions of the text

Eugenics […] is particularly associated with the mass-sterilization campaigns that began after Indiana’s 1907 act, and with the Nazi racial-hygiene programme that reached its nadir in the Holocaust. Another legacy of the eugenics movement is the management of populations using techniques such as demography, racial classification and statistical modelling. These, combined with family planning, became synonymous with modernity and progress. From Latin America and Scandinavia to India, China and the Soviet Union, eugenics took root in projects to ‘improve the population’ throughout the twentieth century. […] The stereotype of bureaucratic, box-ticking ethical compliance is no longer fit for purpose in a world of CRISPR twins […]

Das Problem des Ethikrates

Das Problem des Ethikrates?

Der Rat nimmt Stellung zu allen möglichen und unmöglich Themen, kann aber häufig die Fakten nicht einordnen oder wertet zudem mit wenig rationalen Kriterien.. Das war schon bei der (ersten) “Biobanken” Empfehlung so, das war bei dem “wohltätigen Zwang” so, geht weiter mit den Keimbahn Empfehlungen und dubiosen Datenschutz Vorstellungen.

Auch bei den “Masern” ist das offensichtlich. So jedenfalls das Ärzteblatt in der jüngsten Stellungnahme “Kinderärzte halten Ethikratvotum zu Masernimpfungen für wirklichkeitsfremd”.

Die Kinderärzte:

„Der Ethikrat erkennt an, dass Kinder – und auch ungeimpfte Erwachsene – gegen Krankheiten geimpft werden sollten, die damit eingedämmt oder sogar ausgerottet werden können“, sagte BVKJ-Präsident Thomas Fischbach. Er weise auch darauf hin, dass jeder Mensch die moralische Pflicht habe, sich solidarisch zu verhalten mit de­nen, die sich aus medizinischen Gründen nicht selbst per Impfung schützen könnten. „Doch die moralische Pflicht anzuerkennen und die rechtliche Pflicht abzulehnen, das halten wir für wirklichkeitsfremd“, monierte Fischbach.

Vielleicht sollte man sich auch in Erinnerung rufen, dass in der Sterbehilfedebatte die Mehrzahl der deutschen Ethiker sich für den fraktionsübergreifenden Vorschlag Künast/Sitte/Lauterbach ausgesprochen hatten, genau den Vorschlag, der dann  im Bundestag durchfiel?

Und zum Glück wurde nun auch die Impflicht gegen die Empfehlung des Ethikrates im Kabinett beschlossen und wird wohl auch durch den Bundestag gehen, die Länder müssen wohl nicht zustimmen.

Wenn Ethik sich mit den theoretischen Voraussetzungen und der Bewertung menschlichen Handelns befasst,  dann erfüllt der Ethikrat mehr oder weniger seinen Zweck.

Wenn es aber um die Schlussfolgerungen  geht – die praktische Anwendung der Ethik in der Moral – dann ignoriert man den Ethikrat besser. (“Dabrocks Bauchladen”)

Und hat hat der Ethikrat bisher irgendetwas Sinnvolles zum Thema Klima produziert?

Profiziert

Diet Stellungnahme “Eingriffe in die menschliche Keimbahn” des deutschen Ethikrates 2019 hat auf S. 86 einen netten Schreibfehler, den das Redaktionsteam und alle 26 Autoren übersehen haben.

Seit der wissenschaftlich-industriellen Revolution ist „moderne“ Wissenschaft und Technik durch eine zweifache Komplikation ausgezeichnet: Die technikgestützte Handlung erfüllt zum einen als Mittel ihren Zweck nur noch mit einer gewissen Wahrscheinlichkeit, unter anderem deshalb, weil zwischen Ausgangssituation und Endzweck oft viele Vermittlungsstufen mit unübersehbaren Folgen liegen (Handeln unter Bedingungen der Unsicherheit).
Zum anderen gilt: Wer die Gefahren bei wissenschaftlich-technischen Prozessen trägt, profiziert nicht automatisch auch davon (Handeln unter Bedingungen der Ungleichheit der Betroffenen). Darüber hinaus stellt sich das Problem, dass manche Folgen eines Handelns – etwa aufgrund unüberschaubarer Wechselwirkungen mit anderen Handlungen oder Einflussfaktoren – gänzlich unabwägbar sein können (Handeln unter Bedingungen der Unabwägbarkeit der Folgen).

profiziert? Zuerst dachte ich an provoziert oder profiliert. Mit dem weiteren Verlauf ist aber dann doch eher profitiert gemeint. Vielleicht ist es aber ein Neologismus des Ethikrates der “für den allgemeinen Gebrauch eine sprachliche Neuprägung” erwägt? Dass man das Thema im Sinn von Lindner FDP den ProfiProfs überlassen soll?

Ein entschlossenes “Möglicherweise”: der Ethikrat zu Genome Editing

Wie andere verstehe nicht, warum der Ethikrat Grundsätzliches von sich geben will? Um die eigene Unsterblichkeit in der ansonsten säkularen Welt zu behaupten? Und warum suggeriert er einen Konsens, wo sich hier doch schier unüberwindbare Konflikte auftun?

Nachdem ich nun das ganze Dokument gelesen habe, frage ich mich

1) für wen spricht der Ethikrat eigentlich – für die Politiker/innen, die ihn berufen hat? Für die Wissenschaft, wo die meisten Mitglieder herkommen? Oder spricht doch jeder Rat nur für sich selbst bzw seine Peer Group – Medizin, Soziologie, Theologie, Jura? Dann ist er nicht so wichtig, wie er genommen wird, denn seine Meinung wechselt mit der wechselnden Zusammensetzung des Rates.

2) was Dokument eigentlich will? Ein Moratorium habe andere auch schon gefordert (zB Leopoldina & DFG bereits 2015) und das nicht nur früher, sondern auch deutlich eloquenter. In der eindeutigen Uneindeutigkeit des Ethikrates, alles aneinander reihen zu wollen, liegt die Stellungnahme auf der Linie des Nuffield Reports oder des US Academy Reports, bei denen sich He Jiankui das Passende herausgepickt hat.

Ich halte es da mehr mit Wolfgang Huber (bei dem ich 1979 in Marburg mein allererstes Seminar an der Alten Uni besucht habe). Er

… sprach sich dafür aus, die Bereiche der Pluralität von ethisch geprägten Lebensformen und einer allgemein geltenden Moral zu unterscheiden, sie jedoch nicht beziehungslos nebeneinanderzustellen. Mit einer Gleichgültigkeit gegenüber der Frage nach dem Guten verblasse auch die Frage nach den Motiven und Antrieben, die Menschen dazu veranlassen können, sich auch gegen Widerstände an solchen Regeln zu orientieren. Die bloße Kenntnis universaler Regeln reiche nicht aus. Man benötige auch die Bereitschaft, sich für sie einzusetzen. “Wer in einer pluralen Welt an gemeinsamen moralischen Normen interessiert ist, muss deshalb fragen, wie diese sich an unterschiedliche ethische Grundhaltungen zurückbinden lassen.” Notwendig sei, eine “Kultur der Verantwortung”…

 

Warum das Beispiel “Mukoviszidose” des Ethikrates zu Genome Editing unglücklich ist

Der Deutsche Ethikrat betrachtet in seiner Analyse ein hypothetisches Fallbeispiel, bei dem beide Elternteile an Mukoviszidose erkrankt sind und sich ein gemeinsames Kind wünschen. In diesem Fall würde ein Keimbahneingriff den Eltern den einzigen Weg eröffnen, ein gesundes, genetisch mit beiden Partnern verwandtes Kind zu bekommen. Sie könnten zum Beispiel an einer ersten klinischen Studie zu Keimbahneingriffen teilnehmen, falls die bisherige Forschung eine dafür ausreichende Sicherheit und Wirksamkeit der Technik nachweisen konnte.

Gesund und genetisch verwandt schliesst sich hier in der Tat aus, allerdings nur, wenn beide Eltern dieselbe Mutationen im CFTR Gen haben. Das ist in 70-80% der Patienten der CF (cystische Fibrose, “Mukoviszidose”) der Fall mit der deltaF508 Deletion. Insgesamt gibt es aber über 2,000 beschriebene Mutationen, die in 7 Klassen eingeteilt werden (de Boeck 2017).

Ein paar Zahlen: Es gibt ca 80.000 CF Patienten weltweit, pro Jahr werden ca 200 Schwangerschaften (in England) registriert, bei denen ein Elternteil CF hat.  Mit einer Heterozygotenrate von 1/50 und damit einer Prävalenz von (1/50^2)^2 ist die Konstellation aber für ein doppelt homozygotes Paar jedenfalls extrem selten. Wenn wir von Deutschland ausgehen: Bei 784.000 Geburten jährlich und ohne “assortative mating” liegt die Inzidenz bei 784.000*(1/50^2)^2= 0,12 , oder anders ausgedrückt – das Ereignis kommt nur ca alle 8 Jahre einmal vor. Und da erst in den letzten Jahren die Lebenserwartung überhaupt in das Erwachsenenalter reicht, hat wohl kaum ein deutscher Humangenetiker diesen Beratungsfall jemals gehabt. Macht es also Sinn, eine ethische Betrachtung über einen praktisch nicht vorkommenden Fall anzustellen?

Zudem kommt: 98% der CF Männer sind infertil (bilaterale Aplasie des Vas deferens), d.h. eine Schwangerschaft lässt sich nur über eine testikuläre Spermienextraktion und anschliessende IVF bewerkstelligen. 50% der Frauen haben zudem novulatorische Zyklen und erhöhte Viskosität des Zervixsekrets. Es ist also – selbst wenn es diesen einen Fall tatsächlich einmal geben sollte – praktisch nicht möglich, auf natürlichem Weg schwanger zu werden. Dazu bringt die Schwangerschaft auch für die Mutter zusätzliche Risiken, so dass aktuell Ethikkomitees eine PID bei CFTR Mutationen ablehnen.

Quelle: https://www.pid-zentrum.de/files/public/Downloads/Vortraege/Bonn-DGPGM_PID.pdf

Wer kümmert sich um das Kind, wenn stationäre Aufenthalte für beide Eltern nötig werden? Die Lebenserwartung beider Eltern reicht auch jetzt kaum bis zur Volljährigkeit des Kindes. Angenommen die Eltern bekommen ihr Kind mit 18 Jahren, dann werden die meisten die Volljährigkeit ihres Kindes nicht erleben trotz aller Fortschritte der Medizin denn mit 36 Jahren leben (leider) nur noch 25% der CF Patienten.

2017 Cystic Fibrosis Foundation

Ist das Beispiel CF damit für den Ethikrat wirklich ein praxisrelevantes Beispiel für die Notwendigkeit eines Keimbahneingriffes? Was soll in dem Zusammenhang die Spekulation über eine  klinische Studie, die es schon aus statistischen Gründen nie geben wird? In der Editing Szene dreht sich alles um CCR5 weil sich so ein CFTR Paar nicht auftreiben lässt.

Unter Punkt 95) führt der Ethikrat dann noch weiter aus:

Natürlichkeitsargumente sind im gegebenen Anwendungsszenario von untergeordneter Bedeutung. Wohl kaum jemand wird das zufällige, „natürliche“ Vorliegen des Mukoviszidose-Gens als einen bewahrenswerten Aspekt der Natur des Menschen verstehen.

Nicht dass ich hier mit der Natürlichkeit argumentieren wollte, aber CFTR Mutationen sind ein klassische Beispiel für Heterozygotenvorteil, daß Individuen einen größeren Fortpflanzungserfolg haben/hatten – dem CFTR wird Schutz gegen Cholera, Asthma und eine Kälteanpassung zugeschrieben. Steht auf Wikipedia aber auch jedem Humangenetik Lehrbuch.

Eine Vermeidung von Mukoviszidose per Keimbahneingriff könnte dieser Interpretation zufolge als Ausgleich einer Benachteiligung durch die „Lotterie des Lebens“ verstanden werden.

Der Ethikrat sieht das Leben also nicht als Geschenk an uns, sondern als eine Lotterie mit Nieten?

Das war gestern: Der Ethikrat zu Genome Editing

Joachim Müller-Jung in der FAZ über die Stellungnahme des Ethikrates

Die „erwartbaren Manipulationen an der biologischen Hardware des Menschen“, sagte Dabrock, könne man jetzt nicht mehr allein der Wissenschaftsgemeinde überlassen, man müsse „selbst agieren“. Gewollt, getan. Das Ergebnis ist eine auf 230 Seiten ausbuchstabierte „praktische Handreichung“, deren zentrales Ergebnis – nach Buyx die Innovation des Rats – ein ethisches Flussdiagramm ist: ein „Entscheidungsbaum“, mit dem abzuklären wäre, wann und wann nicht ein Keimbahneingriff im Einzelfall möglich sein soll. Früher hätte jeder einzelne der sieben „ethischen Orientierungsmaßstäbe“ – Menschenwürde, Lebens- und Integritätsschutz, Freiheit, Natürlichkeit, Schädigungsvermeidung und Wohltätigkeit, Gerechtigkeit, Solidarität und Verantwortung – ausgereicht, Keimbahneingriffe (auch den an möglicherweise todbringenden Genen) grundsätzlich zu verhindern. Aber das war gestern.

Mittlerweile treiben 9 von 10 Frauen Kinder mit Down-Syndrom ab statt ohne sich mit Therapieversuchen abzugebenMenschenwürde, Integritätsschutz, Solidarität?

Hohe Ideale, aber wenn es die technischen Möglichkeiten gibt, dann interessiert sich bestimmt kein Paar, was sich der Ethikrat an Entscheidungsbaum ausgedacht hat. Es ist in der Tat viel Mühe, ein Kind mit Down Syndrom aufzuziehen. Carina Kühne, die selbst Down Syndrom hat, sagt aber

Für mich wäre es viel besser, wenn es den Test gar nicht gäbe. Es ist traurig, dass neun von zehn Föten abgetrieben werden. Ich wäre auch gegen eine Fruchtwasseruntersuchung. Wenn ich wirklich ein Kind mit Behinderung bekommen würde, würde ich es annehmen und liebhaben. Wenn es irgendwann gar keine Menschen mit Down-Syndrom gibt, wäre das für die Gesellschaft sehr schade.

Wenn nun in der Öffentlichkeit die neue Stellungnahme  des Ethikrates so ankommt, dass “Keimbahneingriffe derzeit zu risikoreich, aber ethisch nicht grundsätzlich auszuschließen” sind, dann ist der Umbau der solidarischen Gesellschaft damit weiter im Gang.

Jetzt also ein “Flussdiagramm” mit dem finalen Outcome, dass Keimbahneingriffe zulässig sind?

Quelle: https://www.ethikrat.org/fileadmin/Publikationen/Stellungnahmen/deutsch/entscheidungsbaum-keimbahneingriff.pdf

Das Diagramm ist  (ungewöhnlicherweise) horizontal orientiert. Steht das auch symbolisch dafür, wie oberflächlich der Inhalt ist?

Selbst wenn man sich überhaupt auf eine solche Sicht einlässt – die Konsequenzen K6.1 … K6.3 “Keimbahneingriffe sind zulässig” bleiben generell schwer unterscheidbar.

  • K6.1. “monogen” ist technisch machbar, wird aber viele Enttäuschungen produzieren, denn es gibt viele monogene Anlagen, die nicht exprimiert und damit auch nicht korrigiert werden, aber mit variabler Penetranz in der nächsten Generation auftreten können.
  • K6.2. “polygen” ist technisch nicht im entferntesten vorstellbar, weil es keinen einzigen Tierversuch gibt, der je ein polygenes Risiko korrigiert hätte.
  • K6.3. “enhancement” ist technisch  machbar. Auch wenn nun die Erlaubnis zu Gendoping nicht gleichzusetzen ist mit der Abschaffung des Leistungssports (vgl Pechstein Sphärocytose oder Semenya Hypernadrogenämie) aber Olympia, Weltmeisterschaft und Tour de France sind dann sinnlos.
  • Die Übergangsbedingungen B1 und B2 sind mehr oder weniger identisch und damit lapidar, obwohl hier der meiste Sprengstoff vergraben liegt. Der komplette Block “Klinische Studien” in dem Diagramm ist zudem hochgradig redundant. Auch wenn das ganze mehr oder weniger den Zulassungszyklen der Pharmaentwicklung von präklinischen Forschung über Phase I -IV nachempfunden ist mit Tausenden von Teilnehmern, so geht es hier um Einzelfallentscheidungen, die sicher nicht der Logik der Medikamentenentwicklung folgt.
  • Es bleibt also lediglich der Bereich Grundlagenforschung. Was soll aber hier das angeflickte “nur als letztes Mittel” bei der “Embryonenforschung”? Die entscheidende Frage ist doch im Vorfeld, ob man Keimbahntherapie will, denn Forschung zu Keimbahntherapie wird letzendlich immer Embryonenforschung sein.

Letzendlich ist das ganze Digramm sinnlos, weil es keine Klärung der wichtigen Fragen bringt. Flowdiagramme beschreiben auch im sonstigen Gebrauch etwas ganz anderes – Arbeitsabläufe, die auf Entscheidungskriterien basieren – etwa als Illustration eines Algorithmus.

Binärer Entscheidungsbaum zur Vorhersage, ob ein Apfelbaum Früchte tragen wird. Quelle Wikipedia, André Flöter

Im Flussdiagramm des Ethikrates steht aber an keiner einzigen Stelle ein Entscheidungskriterium, sondern immer nur die wiederkehrende Frage “Darf/soll man…?” Wenn nicht mal klar ist, ob man etwas darf, wie kann dann eine Frage mit einem Soll daraus werden?

Aber kommen wir nochmal auf das Anfangsbeispiel zurück und die Frage nach der Gerechtigkeit. Der Ethikrat geht in 68) darauf ein

Natürlich würde die Freigabe von Genome Editing die Beziehung von Menschen verändern, das “vermutlich” in dem Satz lässt sich problemlos streichen.

Strittig ist es auch nicht, ob die Veränderung negativ oder positiv sind – das hängt lediglich vom Standpunkt ab. Ist der Kapitalismus tendenziell negativ oder tendenziell positiv? Das hängt davon ab, ob man davon profitiert oder nur ausgebeutet wird. In einer gerechten Gesellschaft sollte niemand ausgebeutet werden. In einer gerechten Gesellschaft sollte aber auch niemand das Lebensrecht genommen werden.

An open letter to Dr. Hurlbut

Dear Dr Hurlbut,

given your previous involvement in the experiment of He Jiankui, I would like to make a proposal to you.

As a genetic epidemiologist, I have looked into the technical details of  Dr. He’s presentation in Hong Kong. I am deeply concerned about the two girls and and what the international community could do for the “CCR5 twins” but also for the “PCSK9 baby” that will be born in about 10 weeks.

As the official Chinese investigation report leaves a lot of open question, I suggest that an international commission including also scientists and medical doctors from abroad should examine these children. Very much in accordance to the International Atomic Energy Agency there should a multidisciplinary group be built that is allowed to do on-site visits. While I agree with many other ethicists and geneticists that the children and their parents should not be exposed to the public, I think a group of experts need to examine the children and resequence their genomes to offer them the best care available.

We are not sure if the twins are still alive as a Chinese magazine already wrote last December

Eugenics is a word many associate with America’s historical bans on interracial marriage, Nazi Germany’s quest for Aryan supremacy, and stolen Australian Aboriginal children. Its connection to China’s one-child policy is less obvious, but no less potent. Children were seen as valuable resources, and when only one child was permitted per family, there was tremendous pressure to secure the optimal outcome … “Deformed fetuses” are encouraged to be terminated in China because people who require extra care and function outside conventional norms are largely viewed as burdens on society and the family. In lower tier cities, disabled children are often hidden from view and afforded little dignity or opportunities for upward mobility. When people with disabilities are not being pitied as subhuman, those who manage to overcome societal judgment and obstacles are then trotted out as inspiration porn for able-bodied people. Many Chinese people struggle to see beyond someone’s disability. The Chinese word for “disabled” is made of up characters that mean “incomplete/broken” and “disease/suffering,” leaving little room for a fulfilling existence.

As a genetic community we owe something to these children as we collected all those genomic data and developed also the tools to modify a genome but we did not clearly voice our concerns of a germline based therapy. Based on a previous analysis I am sure that the two girls will have many more deficits than are currently known.

Knowing more about the details would be a further warning sign of doing such experiments.

Kind regards
MW

Komplizierte biologische Familienverhältnisse

Adam: de novo synthetische Biologie. Eva: Transgender iPS Klon, Kains Kinder durch ödipale Inzucht, dann Riesen durch Genmutationen und ein genetisches Bottleneck in der Sintflut, bis hin zur heterologen Insemination zu Beginn unserer Zeitrechnung – komplizierte biologische Familienverhältnisse, die an die Geschichte des Zaddik erinnern.

Ein alter, frommer Jude, ein Zaddik, verließ eines Tages diese verrückte Welt und kam in jener, der wirklichen Welt, vor den Engel, der das Buch des Gedenkens, in welchem die Lebensgeschichte eines jeden verzeichnet ist, hütet und öffnet. Ein Blick ins Buch genügte, und gleich standen zwei Engel bereit, den Zaddik ins Paradies zu führen. Aber der Zaddik steht still und will nicht weggehen. Denkt sich der Engel: er hat recht. Zwei Engel sind zu wenig Ehre, und gleich war ein Engelschwarm bereit, den Zaddik ins Paradies zu führen. Aber der Zaddik geht nicht von der Stelle und sagt schlicht und einfach: ? Ich verdiene es nicht!? Entsteht eine Aufregung; Ah! Ein wahrer Zaddik! Man will ihn ins Paradies führen, und er will nicht!
Als der Herr der Welt von der Sache hört, ruft er den Zaddik zu sich und will wissen, was los ist. Sagt der Zaddik; “Rebojne Schelolam! Du kennst doch die Wahrheit! Ich habe zwei Kinder, eine Tochter und einen Sohn. Ein Unglück hat mich getroffen: Meine Tochter ist gestrauchelt und hat vor der Hochzeit ein Kind geboren und mein Sohn hat sich taufen lassen!”
Da tröstete ihn der Herr der Welt!: “Mein Lieber, es hätte, Gott behüte, noch Ärgeres passieren können! Meine Tochter Miriam hat auch ein Kind, einen Sohn, vor der Hochzeit geboren, und als der groß war, hat er sich taufen lassen. Aber das ist noch nicht alles! Nachher hat man sogar behauptet, daß ich der einzige Vater von dem Kind bin!”

Fundamental and non fundamental objections of genome editing in humans

Braun, Schickl and Dabrock try to “map the underlying ethical arguments” (p6ff in “Moral Hazard” 2018) against human genome editing.

The various objections against germline genome editing can basically be divided into (1) fundamental (i.e. against the context of research and application) and (2) non fundamental (i.e. only against the context of application) arguments. The most prevalent fundamental arguments are (a) arguments of human dignity (b) arguments of naturalness and (c) slippery slope… The most common argument within the ethical (as well legal) debate on the use of genome editing techniques, like CRISPR technologies, is the safety argument as a non fundamental objection.

While I think the differentiation of fundamental vs non-fundamental is important for discriminating relevant from irrelevant arguments, the definitions are not fully clear. What is “context of research” – subject, object or objective? And what is “context of application” – the procedural conditions?

“Fundamental” may not be the best label as “fundamental” in German usually claims to be the  only right doctrine. Anyway, a fundamental argument will be an argument that cannot be easily overcome by a counter-argument as it is it is deeply grounded, heavy-weighted and basis for other conclusions.  A non-fundamental is just a non fundamental argument that can be rebutted immediately or in the foreseeable future.

The classification of fundamental by Braun, Schickl and Dabrock is even problematic as well. “Naturalness” is not a fundamental argument as it is nearly impossible to define a “natural” human genome. IMHO “slippery slope” is also not a logical argument at all – having more fear mongering elements than a  strict consequentialist logic.

I would therefore like to split any fundamental objections by the disciplines where they originate: (a)  philosophical/theological anthropology (b) biology and (c) sociology.

FUNDAMENTAL OBJECTION
-- anthropology
  .. human dignity
  .. missing embryonal consent
  .. genetic heteronomy
-- biology
  .. off target risks / safety
  .. unknown genetic background effects
  .. unknown next generation effects
  .. dissolution of species boundaries
-- sociology
  .. missing societal consensus
  .. new naturalism
  .. new eugenics
  .. new racism
NON FUNDAMENTAL OBJECTION
  .. medical necessity
  .. ethics vote
  .. no pre-tests
  .. no trial exit strategy
  .. conflicts of interest
  .. consent without alternatives
  .. and all Krimsky rules

Safety could of course could be a fundamental argument as set out by Nüsslein Vollhard: we can not 100% predict from one cell the fate from another cell.

Maybe this very first classification of arguments could be a further step into a more rational ethical discussion.

Braun, Schickl and Dabrock write on the same page that “the potentiality argument … which is considered to be the strongest argument for absolute embryo protection, is increasingly criticized by ethicists” citing Schöne-Seifert et al 2013 and  themselves as Schickl et al 2014. Their argument: we can reprogram now adult cells, the potentiality is therefore not a unique property of the human embryo, the embryo therefore has not any unique value, the embryo does not need protection.
I ask – instead of REVOKING potentiality of the human embryo why not EXPANDING potentiality to reprogrammed stem cells?
I have also doubts that a “reprogrammed” stem cell will ever have the unique potentiality of an embryo in situ for 3 reasons:
1. a stem cell is not a de novo creation but just a replication.
2. a stem cell will never replicate the complicated epigenetic pattern of an embryonic cell (which is a unique part of the embryonic identity, putting the Schickl argument in a row of genetic exceptionalism arguments).
3. lastly there is never ever maternal support of a stem cell, ignoring the complex biological support chain of human embryos.

And of course potentiality cannot be denied from a biological standpoint. It can be even exactly quantified: One of three fertilized eggs will develop into a human.

(TBC)

CRISPR CAS Babies: Doubt on the Sanger sequences

Using the new inDelphi (Nature 2018) prediction we can examine the gRNA guided cut used for the CRISPR Baby experiment. The results are somewhat unexpected

Maybe it is difficult to extrapolate from mouse to human embryonic stem cells but one observed event is not even listed here.

The results marked with a star have been observed

The -15 genotype has a probability of less than 0.05%. For +1 genotype the probability is 0.09% and for the -4 deletion it is 3.74%.

Looking therefore again at the Hong Kong slides of He Jiankui, I am getting doubts if the chromatogram  of embryo 2  is correct interpreted even if we admit that the labels of embryo 1 and 2 have been switched..

Color enhanced + sharpened version Hong Kong slide. Unfortunately the chromatograms do not expand to the left also.

Embryo 2 does not show a clean  sequence at all and certainly not a -4/+1 genotype as indicated everywhere “ATTTTCCATACAG-ATTCAATTCTGGACTAAAATAAATACCT” isn’t even a human sequence at all.

Gene Editing

Die Entwicklung des Gene Editing ist schwer nachvollziehbar ohne detaillierte Kenntnisse der Enzymchemie. Das neueste LJ 12/18 hat auf S.44 eine exzellente Beschreibung von BE1 (mutiertes dCas9 mit APOBEC1-Cytidin-Deaminase, Einzellstrang R Loop),  BE2 (Uracil-Glycosylase-Inhibitor), BE3 (dCas9 mit Nick), HF-BE3 (high fidelity), BE4-GAM, BE4max, bis zum ABE 7th generation…

Das Basen-Editing tüftelten David Ruchien Liu und seine Mitarbeiter vom Broad-Institut in Cambridge, USA, aus. Sie kombinierten CRISPR-Cas-Komponenten mit Bestandteilen der mRNA-Editiersysteme, die sowohl Pro- wie auch Eukaryoten benutzen. Liu fasste die Methode in einer Presseerklärung so zusammen: „Wir haben programmierbare molekulare Maschinen entwickelt, die an einer von uns aus- gewählten Stelle im Genom eine Base austauschen, ohne dabei einen Doppelstrangbruch in die DNA einzufügen.“

Was noch fehlt?  Die bisherigen BE können bisher nur  Pyrimidine C -> T und T -> C, oder Purine A -> G und  G -> A Transitionen. Das Problem sind Transversionen von  Purinbase nach Pyrimidinbase oder umgekehrt also  T -> A oder C->G, denn dafür gibt es keine Enzyme.

Off target sites of the CRISPR CAS babies

Unfortunately we don’t know the genome of the Chinese parents which would be necessary for any prediction of genome mutations in the twins . So far we only know one confirmed off target site from Dr. He’s Hongkong slides that reports 5 mismatches.

reported off target site
reported off target site

At least I would expect for statistical reasons, some 1 bp mismatch, some 2bp, some 3bp…, but not just one 5bp off target site.
So we could check several online services with the know sgRNA sequence that Dr. He used.

CRISPOR

CRISPOR finds one region with 2 mismatches (intergenic) and 13 with 3 mismatches (7 intergenic hits, 5x introns (ST8SIA6, CTD-2532D12.5, CNTN5, C2D3, RABGAP1) and 1x exon of ACACA). This doesn’t match the reported off target sequence.

Cas-OFFinder

Cas-OFFinder identifies 5 regions with 2 mismatches (1x intergenic, 2x sites in LIMCH1, 1x intergenic, 1 in BPIFC).

CCtop (yes, I was waiting for that name :-)

COS finds only one intergenic region with 3 mismatches.

CRISPRSCAN

has the best explanation of what it does but cannot search from sgRNA to off-target as many other online tools.

OFFspotter

is spotting 1 intergenic region with 2 mismatches,  3 with 3 mismatches (2 intergenic, 1 in RP11-238K6.1).

Taken these five different predictions together, I can’t make conclusion but think that we need to resequence the families with much higher coverage (150-200x fold coverage) and even compare the mutations with the phenotype of the children.

Phenotype of the CRISPR CAS babies

CCR5 annotation, including the known delta32 Mutation and the three mutations introduced by He Jiankui. PAM=Protospacer adjacent motif, DSB=putative double strand break.

From the CCR5 sequence we get the following amino acid sequences

>sp|WT.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

>sp|-32.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPY
IKDSHLGAGPAAACHGHLLLGNPKNSASVSK

>sp|-15.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCS
SQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

>sp|-4.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFP
YSINSGRISRH

>sp|+1.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPY
KSVSILEEFPDIKDSHLGAGPAAACHGHLLLGNPKNSASVSK

The -15/WT genotype will have both, a normal and a slightly shortened CCR5 giving no HIV protection at all. The -4/+1 genotype may suffer the fate of non-sense mediated decay. Here are the amino acid predictions for each genotype (I reverted to Topcocns as Protter had some problems in generating correct plots).

Wildtype: There are 7 transmembrane alpha helices I to VII, connected by three extracellular loops (ECL1–3) and three intracellular loops (ICL1–3). ECL2, forms a β-hairpin structure (Tan 2013).
Known delta 32
Nana -4 genotype has a much shorter predicted amino acid sequence with missing G protein coupling. Resembles delta 32.
Nana +1 genotype is somewhat longer but missing helices VI and VII. No analogue known.
Lulu -15: resembles wild type, however, will be sensitive to allosteric changes by small-molecule CCR5 inhibitors .

From the original AJHG paper, however, also delta 32 carriers may be HIV infected. As there exists also non-CCR5 dependent virus replication, also Nana is at risk of HIV infection when being virus exposed.