Pages and Endnote

Just found a plugin from Apple that allows Endnote citations in Pages. So Apple is also interested in the science industry :-)

Just in case you arrive here from Google by trying to reformat footnotes as endnotes. Your cursor needs to be on an existing footnote, only then the formatting menu appears top right.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Mania & Ritalin

Mania

https://www.verywellmind.com/symptoms-of-mania-380311

reduced need for sleep
increased rate of speech
flight of ideas
being easily distracted
high self-esteem
an increased interest in goal-oriented activities
psychomotor agitation
increased pursuit of risky or dangerous activities
inappropriate humor
extreme impulsiveness
apparent lack of insight into the consequences of an action
reckless and extravagant spending
hypersexuality and sexually provocative behaviors

Mechanics: Frontal cortex (Brodmann area 9) shows upregulation of mRNA and protein levels of neuroinflammatory and arachidonic acid (AA) cascade markers  linked to increased glutamatergic function.

Ritalin

https://www.rxlist.com/ritalin-side-effects-drug-center.htm#professional

nervousness
agitation
anxiety
insomnia
distractibility
increased attention span
hyperactivity
emotional lability
sweating
psychosis
libido changes

Mechanics:  Methylphenidate inhibits the reuptake of dopamine and norepinephrine, increased dopaminergic and noradrenergic activity in the prefrontal cortex.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Datenschutzethik ?

Peter Dabrock bevorzugt Apple Produkte, sogar imm er dabei am Handgelenk.

Es ist ja auch praktisch, immer informiert zu sein. Dass dann bei der Gelegenheit dann auch andere informiert werden, worüber man selbst informiert ist, nun das liegt in der Natur der Sache, aber wir haben ja einen guten Datenschutz, so sein Credo.

Wir wollen ja die Vorteile, so jedenfalls seine Aussage nach dem Besuch des Silicon Valley, von dem er  mit leuchtenden Augen in Tutzing im November 2018 berichtet hat.

Die Diskussion dazu war kurz, aber ich habe mich dann doch noch zu Wort gemeldet:

… Mit ein paar Tagen Abstand ist mir doch etwas mulmig mit einigen Ihrer Thesen … Es ist illusorisch, dass man den Daten „output“ kontrollieren kann, allenfalls den Daten „input“.
Der Hackerangriff auf den Bundestag oder auf das Kreiskrankenhaus Fürstenfeldbruck (das gerade tagelang stillgelegt war) – so recht Ahnung hat ja niemand mehr von Computern und Netzwerken.
Datenvermeidung ist im übrigen nicht meine fixe Idee, sondern steht im BDSG … Es sollte nun nicht das übliche Totschlag Argument sein, aber die Deutschen haben ihre eigene Geschichte. Es ist nicht mal ein Menschenleben her, da wissen schon viele nicht mehr, dass der Holocaust mit einer Stricknadel begann.
Und das ist auch der Grund warum die Deutschen auch nicht immer mit machen, selbst bei Aktionen, die an sich  sinnvoll wären … Ich sehe da auch kein besonderes Misstrauen in Deutschland, sondern eine vernünftige Nutzen / Schaden Abwägung. Ein Frage des Kontextes oder Framings wie Sie gesagt haben.
Und was passiert mit Ihren ganzen Daten wenn sich auf einmal sich das Blatt in der Politik wendet, die Rechten wieder die Überhand gewinnen, die PiS in Polen, die AfD in Deutschland, die Fidesz in Ungarn, die Lega in Italien?
Oder wenn direkt vor Ihrer Haustür ein Beamter mit dem bayrischen Polizeiaufgabengesetz  in der Hand steht und eine “drohende Gefahr“ wittert?

Es geht gerade mal ein paar Tage – und schon wieder sind Firmen mit den besten Rechenzentren der Welt nicht in der Lage, die Datensicherheit zu garantieren, z. B.  Facebook

Facebook soll sensible Nutzerdaten an ausgewählte Werbekunden weitergegeben haben, darunter Netflix, Tinder und Airbnb. Dies berichtet die Washington Post auf Grundlage eines mehr als 200-seitigen Ermittlungsberichts aus Großbritannien.

oder Amazon

Amazon hat einem Kunden in Deutschland, der Auskunft über die von ihm gespeicherten Daten haben wollte, 1700 Sprachdateien zugeschickt. Allerdings besitzt dieser Kunde überhaupt keinen Sprachassistenten, die Dateien stammten von einer ganz anderen Person.

oder Adobe mit 150 Millionen Datensätzen. Das waren alles nur die “Versehen”.  Dabei geht die Strategie weltweit zur  totalen Überwachung, nicht nur in China, sondern auch in den USA und Frankreich.

CLV, das steht für “customer lifetime value”, zu Deutsch: “Kundenlebenszeitwert” – ein neues machtvolles Marketinginstrument, das Unternehmen in den Vereinigten Staaten so elektrisiert wie es Verbraucherschützer alarmiert, denn einen ähnlich groß angelegten Angriff auf die Privatsphäre von Millionen Flug-, Telefon-, Einzelhandels- und sonstigen Kunden dürfte es selbst in der US-Wirtschaftsgeschichte mit ihren dauernden Datenskandalen bisher nicht gegeben haben. Immer mehr Firmen lassen anhand Dutzender, Hunderter, gar Tausender persönlichen Daten berechnen, wie viel ihnen ein einzelner Käufer über sein gesamtes “Kundenleben” wohl in Dollar und Cent einbringen wird.

Trotzdem legt Dabrock nochmal nach auf evangelisch.de am 7.2.2019

Der Ethikratsvorsitzende fügte hinzu, dass der Oxforder Philosoph Luciano Floridi eine treffende Charakterisierung der aktuellen Epoche mit dem Begriff “Onlife” gefunden habe. Dieser mache deutlich, dass man in der heutigen Zeit gar nicht mehr zwischen online und offline unterscheiden könne. Offline sei inzwischen nichts anderes als ein avantgardistischer Lebensstil.

Wir wissen nun auch wieso. Der Tagesspiegel schreibt  am 9. April 2019 über das besondere Verhältnis von Facebook und Dabrock

Für seinen Besuch in Berlin hat Mark Zuckerberg vergangene Woche die Gesprächspartner genau ausgewählt: Der Facebook-Chef traf am Montag unter anderem CDU-Chefin Annegret Kramp-Karrenbauer, den Grünen-Chef Robert Habeck, mit Verbraucherschutzministerin Katarina Barley (SPD) gab es 45 Minuten. Und am Vormittag gleich eineinhalb Stunden für ein Gespräch mit Wissenschaftlern, darunter mit Peter Dabrock, dem Vorsitzenden des Deutschen Ethikrates, der Regierung und Bundestag in ethischen Fragen berät. Doch nicht nur die Kanzlerin mit ihrem Kabinett und die Volksvertreter schätzen Dabrocks Rat – sondern auch Firmen wie Facebook. Seit Januar 2018 leitet Dabrock (55), Professor für Systematische Theologie an der Universität Erlangen, den so genannten „Facebook-Gesprächskreis: Digitalität & Verantwortung“. Die Runde wurde auf Initiative von Facebook hin gegründet, „in enger Zusammenarbeit“ mit Dabrock als dem Vorsitzenden des Ethikrates, heißt es in einer Mitteilung von Facebook zur konstituierenden Sitzung.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Verrückte Experimente

Bisher dachte ich immer, Optogenetik sei die genetische Aufklärung von optischen Anomalien, wie Linsendeformationen oder Netzhauterkrankungen. Aber offensichtlich liege ich damit falsch, wenn ich mir die neue NM Arbeit anschaue, in der ein Hybrid Crispr-Cas9 durch Licht angeschaltet werden kann.

We engineered optogenetic anti-CRISPR variants comprising hybrids of AcrIIA4, a potent Streptococcus pyogenes Cas9 inhibitor, and the LOV2 photosensor from Avena sativa. Coexpression of these proteins with CRISPR–Cas9 effectors enabled light-mediated genome and epigenome editing, and revealed rapid Cas9 genome targeting in human cells.

Die Optogenetik ist ein richtig grosses Feld mittlerweile. Es ist eine interessante Option allemal, die Enzymaktivität intrazellulär an- und abzuschalten zu können.

Die FAZ weiss dazu aber auch ein Experiment, Mäuse auf Knopfdruck im Kreis laufen zu lassen, in dem man den motorischen Cortex über Licht aktiviert. Danke an Juliette Irmer für den Link!

Was für Experimente und was für eine Hybris … Das WSJ zu einem ähnlich gelagerten Tierversuch

The stumbles show the risks of racing ahead with such experiments, even as many governments work to clear regulatory pathways to bring meat, eggs and dairy from gene-edited animals to store shelves. Bioethicists and many geneticists have raised doubts about applying the gene-editing technology to animals and especially humans, given the continued uncertainties in both the science and the lab and field results.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Off target sites of the CRISPR CAS babies

Unfortunately we don’t know the genome of the Chinese parents which would be necessary for any prediction of genome mutations in the twins . So far we only know one confirmed off target site from Dr. He’s Hongkong slides that reports 5 mismatches.

reported off target site
reported off target site

At least I would expect for statistical reasons, some 1 bp mismatch, some 2bp, some 3bp…, but not just one 5bp off target site.
So we could check several online services with the know sgRNA sequence that Dr. He used.

CRISPOR

CRISPOR finds one region with 2 mismatches (intergenic) and 13 with 3 mismatches (7 intergenic hits, 5x introns (ST8SIA6, CTD-2532D12.5, CNTN5, C2D3, RABGAP1) and 1x exon of ACACA). This doesn’t match the reported off target sequence.

Cas-OFFinder

Cas-OFFinder identifies 5 regions with 2 mismatches (1x intergenic, 2x sites in LIMCH1, 1x intergenic, 1 in BPIFC).

CCtop (yes, I was waiting for that name :-)

COS finds only one intergenic region with 3 mismatches.

CRISPRSCAN

has the best explanation of what it does but cannot search from sgRNA to off-target as many other online tools.

OFFspotter

is spotting 1 intergenic region with 2 mismatches,  3 with 3 mismatches (2 intergenic, 1 in RP11-238K6.1).

Taken these five different predictions together, I can’t make conclusion but think that we need to resequence the families with much higher coverage (150-200x fold coverage) and even compare the mutations with the phenotype of the children.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Das Outdoor Filmfestival, die Masern und das Münchner Gesundheitsamt

Radiodurchsage heute 18:00 in München

Beim Outdoor Filmfestival vor einer Woche war auch eine mit Masern infizierte Person. Wenn Sie auf dieser Veranstaltung waren und jetzt Symptome haben, melden Sie sich bitte bei Ihrem Arzt, denn Masern ist eine meldepflichtige Erkrankung.

Wer um Himmels willen im Gesundheitsamt München hat sich das denn ausgedacht? Es gibt es keine spezifische antivirale Therapie.

Statt eines sinnvollen generellen Impfaufrufs, sollen nun im Wartezimmer multimorbide Patienten angesteckt werden? Das RKI sagt

Die weitere Ausbreitung kann durch die postexpositionelle Immunisierung ungeimpfter bzw. nur einmal geimpfter Kontaktpersonen eingeschränkt werden. Diese sogenannte Riegelungsimpfung sollte so schnell wie möglich, idealerweise innerhalb der ersten 3 Tage nach Exposition, erfolgen.

Auf drei sollte man auch im Referat für Gesundheit zählen können.

Referentin für Gesundheit und Umwelt ist seit 1. September 2015 Stephanie Jacobs. Die Juristin und Mutter von zwei kleinen Kindern bringt einen reichhaltigen Erfahrungsschatz aus ihren bisherigen Berufsstationen im Bayerischen Staatsministerium für Umwelt und Gesundheit/Verbraucherschutz mit.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Phenotype of the CRISPR CAS babies

CCR5 annotation, including the known delta32 Mutation and the three mutations introduced by He Jiankui. PAM=Protospacer adjacent motif, DSB=putative double strand break.

From the CCR5 sequence we get the following amino acid sequences

>sp|WT.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

>sp|-32.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPY
IKDSHLGAGPAAACHGHLLLGNPKNSASVSK

>sp|-15.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCS
SQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

>sp|-4.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFP
YSINSGRISRH

>sp|+1.P51681|CCR5_HUMANC-Cchemokinereceptortype5OS=HomosapiensOX=9606GN=CCR5PE=1SV=1
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPY
KSVSILEEFPDIKDSHLGAGPAAACHGHLLLGNPKNSASVSK

The -15/WT genotype will have both, a normal and a slightly shortened CCR5 giving no HIV protection at all. The -4/+1 genotype may suffer the fate of non-sense mediated decay. Here are the amino acid predictions for each genotype (I reverted to Topcocns as Protter had some problems in generating correct plots).

Wildtype: There are 7 transmembrane alpha helices I to VII, connected by three extracellular loops (ECL1–3) and three intracellular loops (ICL1–3). ECL2, forms a β-hairpin structure (Tan 2013).
Known delta 32
Nana -4 genotype has a much shorter predicted amino acid sequence with missing G protein coupling. Resembles delta 32.
Nana +1 genotype is somewhat longer but missing helices VI and VII. No analogue known.
Lulu -15: resembles wild type, however, will be sensitive to allosteric changes by small-molecule CCR5 inhibitors .

From the original AJHG paper, however, also delta 32 carriers may be HIV infected. As there exists also non-CCR5 dependent virus replication, also Nana is at risk of HIV infection when being virus exposed.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Putting ‘scientific’ on a bottle of tonic often just a money-making scheme

A reader of the Guardian is now better informed than many scientists

The fact that lots of healthy living schemes claimed to be scientific tells us something about the power, authority and appeal of science at the time. It’s easy to be cynical and suggest that putting ‘scientific’ on a bottle of tonic was just a crude money-making scheme – and sometimes that was the case. But clearly some of the people involved believed that they were right, and that they were doing important scientific or medical work. They had been trained in the same institutions and taken the same exams as their critics. So how could they disagree over whether they were ‘faddists’ or ‘scientists’? And how can we as lay people tell the difference?
Part of the problem is the difficulty in defining science. While it’s practised by all sorts of different people, with different qualifications in different places, one thing that’s supposed to be constant is the scientific method. Many scientists, and most of us who study science, recognise that there isn’t actually a single, unifying ‘Scientific Method’, but that doesn’t stop people trying to find it, and there’s a ‘common sense’ version that’s often suggested, which runs something like this:
(1) Form hypothesis (2) design experiment to test hypothesis (3) run experiment (4) adjust hypothesis according to results

 

CC-BY-NC Science Surf , accessed 27.03.2026

A mistake in the operating room

Found at https://www.nature.com/articles/ncpuro0294#article-info via https://twitter.com/MaartenvSmeden/status/1071138625415458817

A mistake in the operating room can threaten the life of one patient; a mistake in statistical analysis or interpretation can lead to hundreds of early deaths. So it is perhaps odd that, while we allow a doctor to conduct surgery only after years of training, we give SPSS® (SPSS, Chicago, IL) to almost anyone. Moreover, whilst only a surgeon would comment on surgical technique, it seems that anybody, regardless of statistical training, feels confident about commenting on statis- tical data. If we are to bring the vast efforts of research to fruition, and truly practice evidence- based medicine, we must learn to interpret the results of randomized trials appropriately.

 

CC-BY-NC Science Surf , accessed 27.03.2026

ICMJE Conflicts of Interest – spyware?

I dont’t understand why the ICMJE Conflicts of Interest of the Vancouver group is NOT distributed as a standard PDF but as an Adobe Form that can be opened only after installing a lot of unnecessary software that opens a lot of unnesssary ports transmitting a lot of unnecessary data. This is how it looks natively on a Mac

 

and this is how it should look like

Adobe Acrobat Reader DC does not even allow printing into a PDF, clearly spyware behavior forcing data collection on an unknown destination.

 

CC-BY-NC Science Surf , accessed 27.03.2026

Viel hilft viel

Immer wieder wird Deutschland ein flächendeckender Vitamin-D-Mangel attestiert. So schrieb beispielsweise die Deutsche Gesellschaft für Ernährung in ihrem Bericht, den sie im Sommer veröffentlichte, rund 30 Prozent der Erwachsenen seien nicht ausreichend mit Vitamin D versorgt. Wobei Ältere als Risikogruppe gelten und bei Seniorinnen der Mangel aber ausgeprägter ist als bei Männern. Für Personen mit hohem Risiko für einen Vitamin-D-Mangel erachtet es die DGE für notwendig, ein Vitamin-D-Präparat einzunehmen, um den Bedarf zu decken. Evidenz für eine generelle Substitution gibt es zwar nicht. Aber anscheinend führen solche Berichte und das zugehörige Medien-Echo dazu, dass eigenmächtig ohne Rücksprache mit Arzt oder Apotheker Vitamin D eingenommen wird – und zwar nach dem Motto: „viel hilft viel“

Wer glaubt schon der Deutsche Gesellschaft für Ernährung? Immerhin doch Einige: Die Deutschen Apothekerzeitung berichtet aktuell über zwei Fälle von akuten Nierenversagen bei ausgeprägter Hyperkalzämie,.

 

CC-BY-NC Science Surf , accessed 27.03.2026

All humans, and two ancestors?

Daily Mail reports a study in Human Evolution with comments at phys.org

A scientific study has prompted speculation that all modern humans could have descended from a solitary pair who lived 100,000 to 200,000 years ago.
Scientists surveyed the genetic ‘bar codes’ of five million animals – including humans – from 100,000 different species and the results have prompted speculation that we sprang from a single pair of adults after a catastrophic event almost wiped out the human race.
These bar codes, or snippets of DNA that reside outside the nuclei of living cells, suggest that it’s not just people who could have come from a single pair of beings, but nine out of every 10 animal species, too.

I have heard that before.

 

CC-BY-NC Science Surf , accessed 27.03.2026

The not so revolutionary phenotype

While scanning the internet for the crispr’d babies I found some bizarre accounts. One of these is “Revolutionary Phenotype” by Jean-Francois Gariépy, a book to appear in late 2018, and more fi than sci.

Suppose you want to have a child, but instead of reproducing in the traditional fashion, you and your mate opt to store your genetic information on a computer. Then, while your genes are digitally stored on the computer’s hard drive, you decide to make a few minor edits—just some slight improvements to ensure your kid will be healthy. You then dump your revised digital genome into a series of DNA molecules, which you inject into a human egg that has been stripped of its own native genome. Nine months later, your flesh- and-blood child is born, and you and your family proceed with your deeply satisfying life. You end up never regretting the decision you have made to modify a few genes in your child’s DNA. Your child likes it too since he has better health and strength compared to most of his peers. He’s already dreaming of having his own genetically- modified children.

Humans are not only determined by their genome. And the human genome is a bit more than a digital sequence. But maybe this misunderstanding is intended to increase sales.

 

CC-BY-NC Science Surf , accessed 27.03.2026